DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Naa11

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001019913.1 Gene:Naa11 / 289482 RGDID:1564723 Length:246 Species:Rattus norvegicus


Alignment Length:193 Identity:47/193 - (24%)
Similarity:72/193 - (37%) Gaps:57/193 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VQLRFLVPDDLTEVRQ---LCQEWFPIDYPLSWYEDITSSTRFFALAAVYNLAII-----GLIVA 90
            :.:|...|:||..::.   ||   .|.:|.:.:|        |:...:...|:.|     |.||.
  Rat     1 MNIRNARPEDLMNMQHCNLLC---LPENYQMKYY--------FYHGLSWPQLSYIAEDEDGKIVG 54

  Fly    91 EIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIG 155
                      .|:|.|.:.                  ||.:..    |:|.||.|.|||||.|:.
  Rat    55 ----------YVLAKMEED------------------PDDVPH----GHITSLAVKRSHRRLGLA 87

  Fly   156 SLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKR-RFTLHSFLPYYYNIRGKGKDGF 217
            ..|:|.....:  .|..|.|.:.||...:|:.|:..|... .|.:....|.||   ..|:|.:
  Rat    88 QKLMDQASRAM--IENFSAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYY---ADGEDAY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 33/138 (24%)
Acetyltransf_1 <136..198 CDD:278980 21/62 (34%)
Naa11NP_001019913.1 RimI 1..153 CDD:223532 47/193 (24%)
Interaction with NAA15. /evidence=ECO:0000250 1..58 16/77 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..246
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.