DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Kat14

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_852082.2 Gene:Kat14 / 228714 MGIID:1917264 Length:779 Species:Mus musculus


Alignment Length:174 Identity:35/174 - (20%)
Similarity:64/174 - (36%) Gaps:56/174 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FLVPDDLTEVRQLCQEWFPIDYPLS---WYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNVN 99
            ::.|:.:..:..:|||:|.....||   .|.|       |::..:|...|:..            
Mouse   639 YVRPNHIPTINSMCQEFFWPGIDLSECLQYPD-------FSVVVLYKKVIVAF------------ 684

  Fly   100 KEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMN 164
                              ||      ::||.....|.:.::|   ||...||.||.:.::..|: 
Mouse   685 ------------------GF------MVPDVKYNEAYISFLL---VHPEWRRAGIATFMIYHLI- 721

  Fly   165 HLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFTLHSFLPYYYN 208
                 :....|.:.||...:| ||:..|:|..|....::..:|:
Mouse   722 -----QTCMGKDVTLHVSASN-PAMLLYQKFGFKTEEYVLDFYD 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 25/132 (19%)
Acetyltransf_1 <136..198 CDD:278980 16/61 (26%)
Kat14NP_852082.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..292
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..345
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..457
RimI 648..760 CDD:223532 34/165 (21%)
Acetyltransf_1 680..749 CDD:278980 22/114 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.