DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and F40F4.7

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001379902.1 Gene:F40F4.7 / 180614 WormBaseID:WBGene00018238 Length:245 Species:Caenorhabditis elegans


Alignment Length:227 Identity:52/227 - (22%)
Similarity:91/227 - (40%) Gaps:58/227 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SAPPSSESTRVDCEHVPLCSIND--------------VQLRFLVPDDLTEVRQLCQEWFPIDYPL 61
            |..|..:. :|| :.|||.:..|              |.|..:.|.::.::::|.::.|||.|..
 Worm    61 SVEPEKQD-QVD-QLVPLINKFDVNGKALKTIAGHGTVHLGEITPHNILQLKKLNEDVFPIAYND 123

  Fly    62 SWYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGI 126
            .:|.:.........| |.||..::|.:...|.           ::||...|              
 Worm   124 KFYVEARYCGELGRL-AYYNDVVVGAVCCRID-----------DISDEKSL-------------- 162

  Fly   127 LPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFF 191
                        |:::||...::|:.|||::|:|..:......|  .:|.::||....|:.|:.|
 Worm   163 ------------YLMTLGTLAAYRQIGIGTILIDYALKLCNKME--EIKTMYLHVQVNNKNAVQF 213

  Fly   192 YEKRRFTLHSFLPYYYNIRGKGKDGFTYVNYI 223
            |||..||....:..||.|  ..:|.:..:..|
 Worm   214 YEKHGFTNDGIIEDYYRI--SPRDAYLLIKRI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 30/132 (23%)
Acetyltransf_1 <136..198 CDD:278980 19/61 (31%)
F40F4.7NP_001379902.1 RimI <122..245 CDD:223532 36/164 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.