DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and natc-2

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_504411.1 Gene:natc-2 / 178916 WormBaseID:WBGene00015074 Length:278 Species:Caenorhabditis elegans


Alignment Length:198 Identity:50/198 - (25%)
Similarity:66/198 - (33%) Gaps:75/198 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 INDVQLRFLVPDDLTE------VRQLCQEWFPIDYPLSWYEDITSSTRFFALAAVYNLAIIGLIV 89
            |||:..  |:..||:|      .|.....| | :|....| |.|::|            .||.::
 Worm   106 INDIMR--LITKDLSEPYSIYTYRYFLHNW-P-EYCFLAY-DQTNNT------------YIGAVL 153

  Fly    90 AEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGI 154
            .::                  ||                |..||..  ||:..|.|..|.||.||
 Worm   154 CKL------------------EL----------------DMYGRCK--GYLAMLAVDESCRRLGI 182

  Fly   155 GSLL----LDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFTLHS-FLPYYYNIRGKGK 214
            |:.|    |||:       :......|.|.|..:|:.|...|....|.... .|.||.|    |.
 Worm   183 GTRLVRRALDAM-------QSKGCDEIVLETEVSNKNAQRLYSNLGFIRQKRLLKYYLN----GG 236

  Fly   215 DGF 217
            |.|
 Worm   237 DAF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 30/137 (22%)
Acetyltransf_1 <136..198 CDD:278980 20/65 (31%)
natc-2NP_504411.1 RimI 94..243 CDD:223532 50/198 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.