DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and daf-31

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_501392.1 Gene:daf-31 / 177622 WormBaseID:WBGene00000923 Length:182 Species:Caenorhabditis elegans


Alignment Length:178 Identity:37/178 - (20%)
Similarity:71/178 - (39%) Gaps:43/178 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DDLTEVRQLCQEWFPIDYPLSWY-EDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNVNKEVIAN 105
            |||..::.......|.:|.:.:| ....|..:...:|..:...::|.::|:::            
 Worm     9 DDLMSMQNANLMCLPENYQMKYYFYHALSWPQLSYIAEDHKGNVVGYVLAKME------------ 61

  Fly   106 MSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAE 170
                            :|.|..|.        |:|.||.|.||:||.|:.:.::|.....:  .|
 Worm    62 ----------------EDPGEEPH--------GHITSLAVKRSYRRLGLANKMMDQTARAM--VE 100

  Fly   171 RHSVKAIFLHTLTTNQPAIFFYEKR-RFTLHSFLPYYYNIRGKGKDGF 217
            .::.|.:.||...:|:.|:..|:.. :|.:....|.||   ..|:|.:
 Worm   101 TYNAKYVSLHVRVSNRAALNLYKNTLKFEIVDTEPKYY---ADGEDAY 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 26/133 (20%)
Acetyltransf_1 <136..198 CDD:278980 18/62 (29%)
daf-31NP_501392.1 RimI 1..153 CDD:223532 37/178 (21%)
Acetyltransf_1 47..123 CDD:278980 22/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.