DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and F54E7.9

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_498219.1 Gene:F54E7.9 / 175784 WormBaseID:WBGene00018831 Length:167 Species:Caenorhabditis elegans


Alignment Length:211 Identity:52/211 - (24%)
Similarity:84/211 - (39%) Gaps:62/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HSAPPSSESTRVDCEHVPLCSINDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFF 74
            ||:|.:..|.             :::|:.:..:::..||.|....||:.|...:|::        
 Worm     9 HSSPSTDNSL-------------ELRLQRVTAENIKTVRILVSSIFPVSYSDKFYQE-------- 52

  Fly    75 ALAAVYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGY 139
                ..|..:.|:::.        |.|.||.::...|.:                ..||   |.|
 Worm    53 ----CMNNELTGVVIR--------NGEAIAIVAVKPENF----------------ETGR---VLY 86

  Fly   140 ILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAI---FLHTLTTNQPAIFFYEKRRFTLHS 201
            |.|.|||..||..|:||.|:|.:      .|:..:..:   .||..|:|:.||.||:.|.|.:..
 Worm    87 IRSFGVHPRHREAGLGSFLMDFV------DEKGKLLKLPHAMLHVQTSNKTAIEFYKNRGFNVDC 145

  Fly   202 FLPYYYNIRGKGKDGF 217
            .:|.||. |....|.|
 Worm   146 LVPQYYQ-RCSPPDAF 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 35/135 (26%)
Acetyltransf_1 <136..198 CDD:278980 24/64 (38%)
F54E7.9NP_498219.1 Acetyltransf_1 30..141 CDD:366181 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.