DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Nat8b

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_598242.1 Gene:Nat8b / 171084 RGDID:621605 Length:222 Species:Rattus norvegicus


Alignment Length:169 Identity:44/169 - (26%)
Similarity:63/169 - (37%) Gaps:38/169 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FFALAAVYNLAIIGLIVAEIKPYRN-VNKEVIANMSDSDELY--TRLSGFPMQDK--------GI 126
            ||.|..::.||  |      :|::| |:|.:..:|:|..:.|  .|.|||.:.:.        |.
  Rat    68 FFLLPFLWFLA--G------QPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGEQVVGTVGA 124

  Fly   127 LP---DSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPA 188
            ||   ...||..  ..:..|.|...||..||...|:..:   |..|.......:.|.|.|....|
  Rat   125 LPVKEPPSGRKQ--LQLFHLAVSSQHRGQGIAKALVRTV---LQFARDQGYTDVVLETSTMQIGA 184

  Fly   189 IFFY-----EKRRFTLHSFLPYYYNIRGKGKDGFTYVNY 222
            :..|     :|......|.|.....||      |..:||
  Rat   185 VTLYLGMGFQKTGQYFPSMLWRLVGIR------FVQLNY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 38/151 (25%)
Acetyltransf_1 <136..198 CDD:278980 15/66 (23%)
Nat8bNP_598242.1 hydrophobic domain 36..80 6/19 (32%)
Acetyltransf_1 91..193 CDD:395465 26/106 (25%)
consensus motif D 109..126 2/16 (13%)
consensus motif A 131..166 10/39 (26%)
consensus motif B 174..194 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.