DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and Nat8f5

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_543160.1 Gene:Nat8f5 / 114020 RGDID:621610 Length:227 Species:Rattus norvegicus


Alignment Length:197 Identity:42/197 - (21%)
Similarity:68/197 - (34%) Gaps:54/197 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EHVPLCSINDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSSTRFFALAAVYNLAIIGLI 88
            ||:|..    .:...|:|..|.         |....||:..  :.|.:...|:..::.|.::...
  Rat    27 EHIPAA----FRYTLLLPKTLL---------FLFAAPLTIV--LASGSWLLAVVCIFFLLLLLRF 76

  Fly    89 VAEIKPYRNVNKEVIA-----NMSDSDELYTRLSG-FPMQDKGILPDSMGRSADVGYILSLGVHR 147
            :|. :|:    ||.:|     :|:|..:.|....| |.:.:.|        ...||.:.:|.|..
  Rat    77 LAG-QPF----KEYVAMCLQTDMADITKSYLNAHGSFWVAESG--------GQVVGIVAALPVKE 128

  Fly   148 S----------H-------RRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKR 195
            |          |       |..||...|:..:   |..|.......:.|.|....|.|:..||..
  Rat   129 SPSGRKQLQLFHLSVSSQCRGQGIAKALVRTV---LQFARDQGYMDVVLETSIIQQGAMTLYEAM 190

  Fly   196 RF 197
            .|
  Rat   191 GF 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 32/147 (22%)
Acetyltransf_1 <136..198 CDD:278980 19/79 (24%)
Nat8f5NP_543160.1 RimI <101..196 CDD:223532 23/103 (22%)
NAT_SF 108..175 CDD:173926 14/77 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.