DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and naa30

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001129721.2 Gene:naa30 / 100192212 ZFINID:ZDB-GENE-081022-73 Length:363 Species:Danio rerio


Alignment Length:233 Identity:46/233 - (19%)
Similarity:76/233 - (32%) Gaps:99/233 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSSESTRVDCEHVPLCSINDVQLRFL-------VPD-------DLTEVRQLCQEWFPIDYPLSWY 64
            |.:|.:|:..|.      :|..:|::       :||       ||:|             |.|.|
Zfish   198 PVAEMSRLALEE------HDESIRYVRYESELQMPDIIRLITKDLSE-------------PYSIY 243

  Fly    65 EDITSSTRFF-------ALAAVYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQ 122
                 :.|:|       ...|:.....:|.||.::..::              :::.|       
Zfish   244 -----TYRYFIHNWPQLCFLAMVEKDCVGAIVCKLDMHK--------------KMFRR------- 282

  Fly   123 DKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQP 187
                           |||..|.|....||.|||:.|:...:..:...:   ...:.|.|..||:.
Zfish   283 ---------------GYIAMLAVDSKFRRKGIGTNLVKKAIYAMVEGD---CDEVVLETEITNKS 329

  Fly   188 AIFFYEKRRFTLHSFLPYYYNIRGKGKDGFTYVNYING 225
            |:..||...|.             :.|..|.|  |:||
Zfish   330 ALKLYENLGFV-------------RDKRLFRY--YLNG 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 25/139 (18%)
Acetyltransf_1 <136..198 CDD:278980 18/61 (30%)
naa30NP_001129721.2 RimI 201..363 CDD:223532 45/230 (20%)
Acetyltransf_1 <282..340 CDD:278980 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.