DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and nat8l2

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001373330.1 Gene:nat8l2 / 100004652 ZFINID:ZDB-GENE-131127-633 Length:229 Species:Danio rerio


Alignment Length:205 Identity:42/205 - (20%)
Similarity:71/205 - (34%) Gaps:50/205 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VQLRFLVPDDLTEVRQLCQE----------WFPIDYPLSWYEDITSSTRFFALA---AVYNLAI- 84
            :.:|...|.|...|..:.:|          .:.:..||    .||.|...:..|   :.|:|.: 
Zfish     8 IVIRHYQPSDREAVETVFREAIEEHINPAFMYAMTRPL----HITISLFIYVSAYILSTYSLVLS 68

  Fly    85 -------IGLI--------VAEIKPYRNVN-KEVIA-NMSDSDELY----TRLSGFPMQDKGILP 128
                   |||:        ...::...|.: |::.| .:.:.|..:    ..:.|.|.....:..
Zfish    69 LMCGGSWIGLVYFCCHEFYAGYVRSRLNTDMKDISAYYLENPDNCFWVAEAEIEGRPQVLGMVAV 133

  Fly   129 DSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAE----RHSVKAIFLHTLTTNQPAI 189
            :....|...|.:..:.|..:.||.|:|..|..       |||    ......|.|.|.:|.:.|:
Zfish   134 EGKKGSEKYGELYRMIVSSACRRTGLGVKLAQ-------TAEDFCRERGFSKIMLSTSSTQKAAV 191

  Fly   190 FFYEKRRFTL 199
            ..|.|..|.|
Zfish   192 ALYFKLGFKL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 32/155 (21%)
Acetyltransf_1 <136..198 CDD:278980 17/65 (26%)
nat8l2NP_001373330.1 Acetyltransf_1 84..199 CDD:395465 24/121 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.