DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa60 and nat8

DIOPT Version :9

Sequence 1:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_001342614.1 Gene:nat8 / 100002956 ZFINID:ZDB-GENE-141216-110 Length:221 Species:Danio rerio


Alignment Length:244 Identity:48/244 - (19%)
Similarity:78/244 - (31%) Gaps:83/244 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 INDVQLRFLVPDDLTEVRQLCQEWFPIDYPLSWYEDITSS---------TRFFALAAVY------ 80
            :::||:|....:||.||:::        :.:...|.|.||         .:.| |..|:      
Zfish     1 MDEVQIRQYREEDLEEVKEV--------FTIGMSEHIPSSCMHVLKQPLAQMF-LGCVFCALLTS 56

  Fly    81 -------NLAIIGLIVAEIKPYRNVNKEVIANMSDSD-------------------ELYTRLSG- 118
                   .||:..|:.|..:....:..:.|....:.|                   |...|:.| 
Zfish    57 SMSILLPVLAVTLLLAAGRQSVCYMFNKYIQTSLEQDLSHIQQTYMDPPNACVWVAESQGRVVGT 121

  Fly   119 ---FPMQ-DKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFL 179
               ||.: ||..|.           :..:.|.::||..||...|...:.:.   |.......:.|
Zfish   122 VGCFPSENDKNFLE-----------LKRMSVKKAHRGKGIAKALCRTVADF---ARERGYLGVIL 172

  Fly   180 HTLTTNQPAIFFYEK------RRFTLHSFLPYYYNIRGKGKDGFTYVNY 222
            ||......|...||.      |.|:...|:....|        ||.:.|
Zfish   173 HTSVVQTDAQKLYEHMGYHKVREFSAPEFIAKLTN--------FTLMEY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa60NP_996032.1 RimI 74..207 CDD:223532 33/175 (19%)
Acetyltransf_1 <136..198 CDD:278980 14/67 (21%)
nat8XP_001342614.1 Acetyltransf_1 76..190 CDD:306954 23/127 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.