DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14174 and Nepro

DIOPT Version :9

Sequence 1:NP_648351.1 Gene:CG14174 / 39139 FlyBaseID:FBgn0036036 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001009678.1 Gene:Nepro / 303948 RGDID:1311458 Length:566 Species:Rattus norvegicus


Alignment Length:388 Identity:72/388 - (18%)
Similarity:143/388 - (36%) Gaps:99/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WNDFKLKQP-PLVTLLVKDTGFAKNVFV--------VINRFLQQLSEPDAKDFEETAAMIGRLMA 62
            ||..|:.|. ...||.|:|.....:|.:        ::.|.|:      ::..:....::..::.
  Rat    12 WNRVKIPQAGNCSTLTVQDPSATLDVCIAAVIKACHLVTRSLK------SRTLDAEVDVLCSVLY 70

  Fly    63 RRKNSFRNMPGFRSVCKLNAALCRLLRLDLARDLKNFRGVLPDVCDEDLGGA-----MPTRSSFE 122
            ...|...:.....::.::...|.||..::|...:::...:|.  .::...||     :|::...|
  Rat    71 SNHNRLGHHRQHLALRQVEQCLKRLKHMNLEGSIEDLSQLLS--ANKTQPGATENRVVPSQPVME 133

  Fly   123 FILVRLLGFYHLHERIRE-CCLSAAAYFTQLLRNNFFMDFTTLLIAAIAKISKLSSLQAGKSAIL 186
            .:|:::||...|..|:.: ||.:    |...:::....:|..|.:..:..:|:|..|..|....|
  Rat   134 VVLMKVLGGCKLLLRLLDRCCKT----FLLTVKHLGLREFIILNLVMVGLVSRLWVLHKGLLRRL 194

  Fly   187 YNKLRPQIANFPQVEKHKFLAENQELPARLEP---------PTRTNN-------QTQKDETPDIV 235
            .:...|            .|..:||: :|::|         |:...:       ...|.:||  .
  Rat   195 ISLYEP------------LLGLHQEI-SRIQPMPYFKDFAFPSNITDFLGSSYLDIFKGKTP--A 244

  Fly   236 LIPKKVVTKVEKAKLLAKSDV----GTIIARKETPVQDTK----------------KPTFNENVL 280
            ....|.|||:.....|.|..:    |..:.:...|.:..|                |.|..|..|
  Rat   245 SFAPKGVTKLLNKLFLMKEQLSETNGDTLDKLSQPCEQMKSSPQSSVDLGQPVKACKRTRKEKPL 309

  Fly   281 --------------ATVADAQKFIERESQARKLNPPPESCFTRKIAKHEWLAAQTMFNRKLSK 329
                          ||...:|:|  :.||::   |......::|:..| | |..|:...:::|
  Rat   310 GFDVRAFCTRLRNKATQETSQQF--KYSQSK---PKTTKLSSQKLRTH-W-ANDTVQRIRMTK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14174NP_648351.1 DUF4477 7..191 CDD:291446 36/198 (18%)
NeproNP_001009678.1 DUF4477 12..202 CDD:291446 37/213 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008336
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34761
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.