DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14174 and Nepro

DIOPT Version :9

Sequence 1:NP_648351.1 Gene:CG14174 / 39139 FlyBaseID:FBgn0036036 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_666084.1 Gene:Nepro / 212547 MGIID:2384836 Length:564 Species:Mus musculus


Alignment Length:369 Identity:70/369 - (18%)
Similarity:136/369 - (36%) Gaps:68/369 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WNDFKLKQ----------PPLVTLLVKDTGFAKNVFVVINRFLQQLSEPDAKDFEETAAMIGRLM 61
            ||..::.|          .|..||.:......|...:|......|..:      .|...:...|.
Mouse    12 WNRVRIPQAGNCSTLTVRDPSATLDICTAAVTKGCHLVTQSLKSQTLD------AEVDVLCSVLY 70

  Fly    62 ARRKNSFRNMPGFRSVCKLNAALCRLLRLDLARDLKNFRGVL------PDVCDEDLGGAMPTRSS 120
            :.......:.|.. ::.::...|.||..::|...:::...:|      |...:..:   :|::..
Mouse    71 SNHNRLGHHKPHL-ALRQVEQCLKRLKHMNLEGSIEDLSQLLSANATQPGATENRV---VPSQPV 131

  Fly   121 FEFILVRLLGFYHLHERIRECCLSAAAYFTQLLRNNFFMDFTTLLIAAIAKISKLSSLQAG---K 182
            .|.:|:::||...|..|:.:||..|   |...:::....:|..|.:..:..:|:|..|..|   :
Mouse   132 VEVVLMKVLGGCKLLLRLLDCCCKA---FLLTVKHLGLKEFIILNLVMVGLVSRLWVLHKGLLRR 193

  Fly   183 SAILYN---KLRPQIANFPQVEKHKFLAENQELPARLEPPTRTNNQTQKDETPDIVLIPKKVVTK 244
            ...||.   .||.:|::...:...|..|...::...|.|   :..:..|.:||  .....|.|||
Mouse   194 LISLYEPLLSLRQEISSIHPMPYFKDFAFPSDITDFLGP---SYLEVFKVKTP--AASATKGVTK 253

  Fly   245 VEKAKLLAKSDVGTIIARKETPVQDTKKPTFNENVLATVADAQKFIERESQAR-KLNPPPESCFT 308
            :.....|.:..:                |..||:.|..::...:.:....|:. .|..|.::|  
Mouse   254 LLNKLFLMREQL----------------PKMNEDTLDRLSKPSEQMTSNPQSTVDLGQPVKAC-- 300

  Fly   309 RKIAKHEWL-----AAQTMFNRKLSKEPEKALNIFRKFIVSKIK 347
            ::..|.:.|     |..|....|.::|..:..    |:..||:|
Mouse   301 KRTRKEKPLGFDLRAFCTRLGNKATQETNRDF----KYSQSKLK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14174NP_648351.1 DUF4477 7..191 CDD:291446 37/205 (18%)
NeproNP_666084.1 DUF4477 12..202 CDD:291446 37/202 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..495
Nuclear localization signal. /evidence=ECO:0000303|PubMed:19906856 442..460
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008336
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR34761
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.