DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vsg and CD164

DIOPT Version :9

Sequence 1:NP_001261646.1 Gene:vsg / 39137 FlyBaseID:FBgn0045823 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_006007.2 Gene:CD164 / 8763 HGNCID:1632 Length:197 Species:Homo sapiens


Alignment Length:226 Identity:69/226 - (30%)
Similarity:93/226 - (41%) Gaps:73/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRQAKFLI---LCLFVGLFSANLCEEVTTPAPADTTTQESKNTTTPPDTTTTVTPPSTSTTSTT 62
            |:|.::.|:   .||.|      ||           .....||||..|: .||:.|.|    :.|
Human     1 MSRLSRSLLWAATCLGV------LC-----------VLSADKNTTQHPN-VTTLAPIS----NVT 43

  Fly    63 TEKTTTTPPITTSTEKT-----------------TT------------------------STTPA 86
            :...|:.|.:||...:|                 ||                        :||..
Human    44 SAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDF 108

  Fly    87 STTSSTTPASTTSSTTPATTTTTPGTTSTTTPSPNSTTTTPPPHTSTTPAPKPVPCGHFDGSSFI 151
            .:.|:.||..|.:||...|...:|.|||.|..:..:|..|      .||..:||....||.:|||
Human   109 CSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNT------VTPTSQPVRKSTFDAASFI 167

  Fly   152 GGIVLTLGLLAIGLVAYKFYKARNERNYHTL 182
            |||||.||:.|:....|||.|:: |||||||
Human   168 GGIVLVLGVQAVIFFLYKFCKSK-ERNYHTL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vsgNP_001261646.1 MGC-24 <145..182 CDD:283050 22/36 (61%)
CD164NP_006007.2 MGC-24 60..197 CDD:283050 45/143 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..154 13/41 (32%)
Required for endosomal and lysosomal localization. /evidence=ECO:0000250 191..197 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147806
Domainoid 1 1.000 77 1.000 Domainoid score I8922
eggNOG 1 0.900 - - E1_2CF8S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009084
OrthoInspector 1 1.000 - - oto91335
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11337
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5635
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.