DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vsg and Tmem123

DIOPT Version :9

Sequence 1:NP_001261646.1 Gene:vsg / 39137 FlyBaseID:FBgn0045823 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_598500.1 Gene:Tmem123 / 71929 MGIID:1919179 Length:195 Species:Mus musculus


Alignment Length:170 Identity:53/170 - (31%)
Similarity:73/170 - (42%) Gaps:24/170 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PADTTTQESKN---TTTPPDTTTTVTPPSTSTTSTTTEKTTTTPPITTSTEKTTTSTT--PASTT 89
            |.|.....|.|   .|:..:.|.......:..::.|:|..:|..|  :...||||..|  ||:..
Mouse    26 PTDAQGSASGNHSVLTSNINITENTNQTMSVVSNQTSEMQSTAKP--SVLPKTTTLITVKPATIV 88

  Fly    90 SSTTPASTTSSTTPATTTTTPGTTSTTTPSPNSTTT----TPPPHT--------STTPAPKPVPC 142
            ..:||     ...|..|.|...:|...:.|||||.|    |.|.|:        |.|..|.....
Mouse    89 KISTP-----GVLPHVTPTASKSTPNASASPNSTHTSASMTTPAHSSLLTTVTVSATTHPTKGKG 148

  Fly   143 GHFDGSSFIGGIVLTLGLLAIGLVAYKFYKARNERNYHTL 182
            ..||..||:||||||||:|:|..:..|.|.:|....|.::
Mouse   149 SKFDAGSFVGGIVLTLGVLSILYIGCKMYYSRRGIRYRSI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vsgNP_001261646.1 MGC-24 <145..182 CDD:283050 18/36 (50%)
Tmem123NP_598500.1 MGC-24 <95..175 CDD:283050 30/79 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 99..127 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11337
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.