DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vsg and Cd164l2

DIOPT Version :9

Sequence 1:NP_001261646.1 Gene:vsg / 39137 FlyBaseID:FBgn0045823 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_081428.1 Gene:Cd164l2 / 69655 MGIID:1916905 Length:172 Species:Mus musculus


Alignment Length:61 Identity:29/61 - (47%)
Similarity:36/61 - (59%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 TTPPPHTSTTPAPKPVPCGH---FDGSSFIGGIVLTLGLLAIGLVAYKFYKARNERNYHTL 182
            :|..|..|||.:| |:|..|   |||:||||||||.|.|.|......:|.||: :..|.||
Mouse   113 STEEPKPSTTGSP-PIPEDHSPGFDGASFIGGIVLVLSLQATAFFVLRFLKAK-DSTYQTL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vsgNP_001261646.1 MGC-24 <145..182 CDD:283050 18/36 (50%)
Cd164l2NP_081428.1 MGC-24 53..171 CDD:283050 27/59 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..132 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837886
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CF8S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11337
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.