powered by:
Protein Alignment vsg and Cd164l2
DIOPT Version :9
Sequence 1: | NP_001261646.1 |
Gene: | vsg / 39137 |
FlyBaseID: | FBgn0045823 |
Length: | 262 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_081428.1 |
Gene: | Cd164l2 / 69655 |
MGIID: | 1916905 |
Length: | 172 |
Species: | Mus musculus |
Alignment Length: | 61 |
Identity: | 29/61 - (47%) |
Similarity: | 36/61 - (59%) |
Gaps: | 5/61 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 TTPPPHTSTTPAPKPVPCGH---FDGSSFIGGIVLTLGLLAIGLVAYKFYKARNERNYHTL 182
:|..|..|||.:| |:|..| |||:||||||||.|.|.|......:|.||: :..|.||
Mouse 113 STEEPKPSTTGSP-PIPEDHSPGFDGASFIGGIVLVLSLQATAFFVLRFLKAK-DSTYQTL 171
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167837886 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CF8S |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11337 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X9493 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.930 |
|
Return to query results.
Submit another query.