DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vsg and tmem123

DIOPT Version :9

Sequence 1:NP_001261646.1 Gene:vsg / 39137 FlyBaseID:FBgn0045823 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001923119.1 Gene:tmem123 / 561344 ZFINID:ZDB-GENE-050419-69 Length:130 Species:Danio rerio


Alignment Length:102 Identity:25/102 - (24%)
Similarity:45/102 - (44%) Gaps:13/102 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TPASTTSSTTPASTTSSTTPATTTTTPGTTSTTTPSP---NSTTTTPPPHTSTTPAPKPVPCGHF 145
            |.::.:..:|..|...|.||  |..:..|...:|||.   :::...||.|.:..        |.|
Zfish    32 TASNMSHYSTHLSKAKSITP--TEASVNTLHISTPSKHLISASIGVPPGHLTAG--------GGF 86

  Fly   146 DGSSFIGGIVLTLGLLAIGLVAYKFYKARNERNYHTL 182
            |..||:||::|...::....|.|:.:.::....|..:
Zfish    87 DAGSFLGGMILAFIIILAVAVGYRLFCSKRAIRYRVI 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vsgNP_001261646.1 MGC-24 <145..182 CDD:283050 10/36 (28%)
tmem123XP_001923119.1 MGC-24 <23..115 CDD:310122 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581656
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.