DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vsg and cd164

DIOPT Version :9

Sequence 1:NP_001261646.1 Gene:vsg / 39137 FlyBaseID:FBgn0045823 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001038256.1 Gene:cd164 / 555639 ZFINID:ZDB-GENE-030131-1598 Length:167 Species:Danio rerio


Alignment Length:190 Identity:66/190 - (34%)
Similarity:84/190 - (44%) Gaps:47/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LILCLFVGL----FSA----------NLCEEVTTPAPADTTTQESKNTTTPPDTTTTVTPPSTST 58
            |:|.|...:    |||          :.||.||.....:.|           |....|.....:.
Zfish    10 LLLALLGSMTSQQFSADEVCSTFHGCDACENVTLCQWMNCT-----------DGFQCVNSSHENQ 63

  Fly    59 TSTTTEKTTTTPPITTSTEKTTTSTTPASTTSSTTPASTTSSTTPATTTTT-PGTTSTTTPSPNS 122
            |:.......|.||:.::....||     |:|::||.|:|...|.|.|.|.. ..|.||||.||  
Zfish    64 TANCVSANCTEPPVASTVNPVTT-----SSTNATTNATTVIPTIPVTPTRNGTDTNSTTTASP-- 121

  Fly   123 TTTTPPPHTSTTPAPKPVPCGHFDGSSFIGGIVLTLGLLAIGLVAYKFYKARNERNYHTL 182
              ||.|..|||           ||.:||||||||.|||.|:....|||.|:: :||||||
Zfish   122 --TTAPSKTST-----------FDAASFIGGIVLVLGLQAVIFFLYKFCKSK-DRNYHTL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vsgNP_001261646.1 MGC-24 <145..182 CDD:283050 22/36 (61%)
cd164NP_001038256.1 MGC-24 29..167 CDD:283050 58/169 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581658
Domainoid 1 1.000 73 1.000 Domainoid score I9222
eggNOG 1 0.900 - - E1_2CF8S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009084
OrthoInspector 1 1.000 - - oto40487
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11337
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5635
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.