DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vsg and Cd164

DIOPT Version :9

Sequence 1:NP_001261646.1 Gene:vsg / 39137 FlyBaseID:FBgn0045823 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_058594.1 Gene:Cd164 / 53599 MGIID:1859568 Length:197 Species:Mus musculus


Alignment Length:223 Identity:68/223 - (30%)
Similarity:88/223 - (39%) Gaps:72/223 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NRQAKFLILCLFVGLFSANLC-----EEVTTPAPADTTTQESKNTTTPPDTTTTVTPPSTSTTST 61
            :|:..:...||.|      ||     ..:||.||         |.|..|.|||.|.|        
Mouse     5 SRRLLWAATCLAV------LCVSAAQPNITTLAP---------NVTEVPTTTTKVVP-------- 46

  Fly    62 TTEKTTTTPPITTS-------------------------TEKTTTSTTPASTTSS---------- 91
            ||:..|..|....|                         ..||..:..|.|..|.          
Mouse    47 TTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVI 111

  Fly    92 --TTPASTTSSTTPATTTTTPGTTSTTTPSPNSTTTTPPPHTSTTPAPKPVPCGHFDGSSFIGGI 154
              |||..|.|:..|.|..::|      ||:|:..|:....:|:.||..:|.....||.:||||||
Mouse   112 PPTTPVPTNSTAKPTTRPSSP------TPTPSVVTSAGTTNTTLTPTSQPERKSTFDAASFIGGI 170

  Fly   155 VLTLGLLAIGLVAYKFYKARNERNYHTL 182
            ||.||:.|:....|||.|:: |||||||
Mouse   171 VLVLGVQAVIFFLYKFCKSK-ERNYHTL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vsgNP_001261646.1 MGC-24 <145..182 CDD:283050 22/36 (61%)
Cd164NP_058594.1 MGC-24 57..197 CDD:283050 44/146 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..156 13/45 (29%)
Required for endosomal and lysosomal localization. /evidence=ECO:0000250 191..197 5/5 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837885
Domainoid 1 1.000 74 1.000 Domainoid score I9171
eggNOG 1 0.900 - - E1_2CF8S
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5220
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009084
OrthoInspector 1 1.000 - - oto94914
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11337
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5635
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.