powered by:
Protein Alignment vsg and cd164l2
DIOPT Version :9
Sequence 1: | NP_001261646.1 |
Gene: | vsg / 39137 |
FlyBaseID: | FBgn0045823 |
Length: | 262 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005159829.1 |
Gene: | cd164l2 / 101883372 |
ZFINID: | ZDB-GENE-120215-174 |
Length: | 150 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 25/72 - (34%) |
Similarity: | 32/72 - (44%) |
Gaps: | 19/72 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 111 GTTSTTTPSPNSTTTTPPPHTSTTPAPKPVPCGHFDGSSFIGGIVLTLGLLAIGLVAYKFYKARN 175
|.|..|||.|..:..: ||.|||||||:|.|.|.|.|..|.:|.|.:
Zfish 94 GGTDNTTPGPQFSQAS------------------FDLSSFIGGIILVLVLQAGGFFAMRFLKTK- 139
Fly 176 ERNYHTL 182
:..|.|:
Zfish 140 DSTYETI 146
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
vsg | NP_001261646.1 |
MGC-24 |
<145..182 |
CDD:283050 |
18/36 (50%) |
cd164l2 | XP_005159829.1 |
MGC-24 |
31..146 |
CDD:310122 |
24/70 (34%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170581657 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CF8S |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11337 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X9493 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.930 |
|
Return to query results.
Submit another query.