DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3PX1 and SNX3

DIOPT Version :10

Sequence 1:NP_648348.1 Gene:SH3PX1 / 39136 FlyBaseID:FBgn0040475 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_015002.3 Gene:SNX3 / 854539 SGDID:S000005884 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:144 Identity:37/144 - (25%)
Similarity:61/144 - (42%) Gaps:27/144 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 EDSIYQWTQNHSPYSVVVASPKK--ESKFKGMKT-----------FIAYQL-----TPSFNN--I 250
            |.|:.........||.:.|.|:.  |.:....||           |..|::     .|||:.  .
Yeast    12 EKSLLSKGHGEPSYSEIYAEPENFLEIEVHNPKTHIPNGMDSKGMFTDYEIICRTNLPSFHKRVS 76

  Fly   251 SVSRRYKHFDWLHERLVDKFCL-----IPVPPLPDK-QISGRYEEQFVEHRRVQLQEFVDWVCRH 309
            .|.|||..|::..:.|:.:..:     :.||.||.| .:|.|:..:.:|.||..|..::..|..|
Yeast    77 KVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERRQGLNTWMQSVAGH 141

  Fly   310 PVI-SKCEVWYHFL 322
            |:: |..:|...|:
Yeast   142 PLLQSGSKVLVRFI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3PX1NP_648348.1 SH3_SNX9_like 4..59 CDD:212697
PX_SNX9_18_like 219..343 CDD:132772 35/131 (27%)
BAR_SNX9_like 362..564 CDD:153310
SNX3NP_015002.3 PX_Grd19 35..160 CDD:132828 31/121 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.