DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3PX1 and Snx3

DIOPT Version :10

Sequence 1:NP_648348.1 Gene:SH3PX1 / 39136 FlyBaseID:FBgn0040475 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_650214.1 Gene:Snx3 / 41551 FlyBaseID:FBgn0038065 Length:167 Species:Drosophila melanogaster


Alignment Length:137 Identity:40/137 - (29%)
Similarity:62/137 - (45%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 QVEDSIYQWTQNH------SPYSVVVASPKKESKFK-GMKTFIAYQLTPSF--NNISVSRRYKHF 259
            |..|..|....|.      :|.:.:.|..|:.:.:: .|:|.:     |.|  ...||.|||..|
  Fly    20 QTLDDAYAVPANFLEIDVVNPLTTMAAGKKRYTDYEVRMRTNL-----PVFKVKESSVRRRYSDF 79

  Fly   260 DWLHERLVDKFCLIPVPPLPDK----QI-----SGRYEEQFVEHRRVQLQEFVDWVCRHPVISKC 315
            :||...| ::...|.|||||.|    |:     .|.::|.|:|.||..|:.|::.:..||:....
  Fly    80 EWLRNEL-ERDSKIVVPPLPGKAWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNE 143

  Fly   316 EVWYHFL 322
            ...:.||
  Fly   144 RCLHMFL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3PX1NP_648348.1 SH3_SNX9_like 4..59 CDD:212697
PX_SNX9_18_like 219..343 CDD:132772 35/116 (30%)
BAR_SNX9_like 362..564 CDD:153310
Snx3NP_650214.1 PX_SNX3_like 32..155 CDD:132804 36/125 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.