DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3PX1 and Snx32

DIOPT Version :9

Sequence 1:NP_648348.1 Gene:SH3PX1 / 39136 FlyBaseID:FBgn0040475 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_006231002.1 Gene:Snx32 / 361708 RGDID:1560591 Length:502 Species:Rattus norvegicus


Alignment Length:343 Identity:68/343 - (19%)
Similarity:119/343 - (34%) Gaps:79/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 QNHSPYSVVVA---SPKKESKFK-GMKTFIAYQLTPSFNNISVSRRYKHFDWLHERLVDK----- 269
            |..||..|.::   |.:.:.||. ..|:.:.:...|.|   ||.|:::.|.|||:..|:.     
  Rat    29 QGDSPLQVEISDAVSERDKVKFTVQTKSGLPHFAQPEF---SVVRQHEEFIWLHDTYVENEEYAG 90

  Fly   270 FCLIPVPPLPDKQISGR------------YEEQFVEHRR-------------VQLQE-FVDWVCR 308
            ..:.|.||.||.:.|..            ..|:|...::             |.:.| |:..:..
  Rat    91 LIIPPAPPRPDFEASREKLQKLGEGNSSITREEFARMKQELEAEYLAIFKKTVAMHEIFLQRLAA 155

  Fly   309 HPVISKCEVWYHFLTCRDEKIWKSGKRKAERDPYMGVNYCLAISPPDKNLLHSKVDAQVELGTQF 373
            ||.:.:    .|.|:...|.......|:..|...:| .:..:|......:|.:.:....|:...|
  Rat   156 HPTLRR----DHNLSVFLEYSQDLSVREKNRKEVLG-GFLKSIVRSADEVLITGISGLKEVDDFF 215

  Fly   374 IHSMDVAVRNLNNISNDMAKRSMSQSKKEFQRIGDGLSDLAKALAIDERRAPTRNAVPLS----- 433
            .|.....|.....| .|..:|:            |.:....|.||        .|.:|||     
  Rat   216 EHERTFLVEYHTRI-RDTCQRA------------DRVMHSHKCLA--------DNYIPLSAALSS 259

  Fly   434 ---ESVGRIGGIFIGIGQAF-------GDQPKHDWIPLSDRLHIYRGVLNCFPDIFSTHKGAIQK 488
               ::|.::...|:.:.:.|       |.....:.:.|||.|..|........|:......|:..
  Rat   260 LGTQAVNQLKRSFLKLAELFERLRKLEGRIASDEDLKLSDMLRYYMRDSQAAKDLLYRRLRALAD 324

  Fly   489 RKDCEKLAGEGRMNNPQL 506
            .::..|...:.|..|.::
  Rat   325 YENANKALDKARTRNREV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3PX1NP_648348.1 SH3_SNX9_like 4..59 CDD:212697
PX_SNX9_18_like 219..343 CDD:132772 33/158 (21%)
BAR_SNX9_like 362..564 CDD:153310 29/160 (18%)
Snx32XP_006231002.1 PX_SNX5_like 34..171 CDD:132802 30/143 (21%)
BAR_SNX5_6 188..>364 CDD:153305 31/176 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.