DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3PX1 and Snx6

DIOPT Version :9

Sequence 1:NP_648348.1 Gene:SH3PX1 / 39136 FlyBaseID:FBgn0040475 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_001245939.1 Gene:Snx6 / 34126 FlyBaseID:FBgn0032005 Length:455 Species:Drosophila melanogaster


Alignment Length:496 Identity:101/496 - (20%)
Similarity:168/496 - (33%) Gaps:147/496 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 TSDYDNKHLPIAPNDDTQSLAS---------VAGGTGA-AGTVKKGMFAKSSDSYILGLSSTKEK 193
            |.|.:..:.|...|..|..:||         ..||..| :|.......|.|.||     ||:...
  Fly     5 TDDSNLLNSPSTNNGATMEIASPTNPLATPPATGGAPAPSGATNGSGSATSPDS-----SSSAPA 64

  Fly   194 IPEC--EMAYITQVEDSIYQWTQNHSPYSVVVASPKKESKFKGMKTFIAYQLTPSF----NNISV 252
            .|..  |.|...::.|::               |.|::.||    |.......|.|    ||  |
  Fly    65 TPAVLGENALHVEISDAL---------------SEKEKVKF----TVHTRTTLPGFSKKDNN--V 108

  Fly   253 SRRYKHFDWLHERLVDK-----FCLIPVPPLPD-----------------------KQISGRYEE 289
            .|:::.|.|||:|:.:.     :.:.|.||.||                       |::....|.
  Fly   109 VRQHEEFVWLHDRIEENDDYAGYIIPPCPPRPDFDASREKLQRLGEGEGNMTKEEFKKMKSELEA 173

  Fly   290 QFVE--HRRVQLQE-FVDWVCRHPVISKCEVWYHFLTCRDEKIWKSGKRKAERDPYMGVNYCLAI 351
            :::.  .:.|.:.| |:..:..|||....:....||....:...|..|:.|   .:.|....|. 
  Fly   174 EYLATFKKTVAMHEVFLRRLASHPVFRVDQHLKVFLEYDQDLCAKPRKKMA---IFGGFVKSLG- 234

  Fly   352 SPPDKNLLHSKV-------DAQVELGTQFI-HSMDVAVRNLNNISNDMAKRSMSQSKKEFQRIGD 408
            ...|:.||.:.|       :.:::..|::. |..:.|:|.          ..|:|..|:   :||
  Fly   235 KTTDEILLSATVRDVNDFFENELQFLTEYHGHLREAALRT----------EKMTQRHKD---VGD 286

  Fly   409 GLSDLAKALAIDERRAPTRNAVPLSESVGRIGGIFIGI----GQAFGDQPKHDWIPLSDRLHIYR 469
            ....::.||.    :..|.....:...|.:...||..|    .:...||.    :.|.|.|..|:
  Fly   287 SHQKISNALT----QLSTTEKGNVETFVAKTAEIFERIKNLETRVASDQD----LKLGDTLRYYQ 343

  Fly   470 -----------GVLNCFPDIFSTHKG---AIQKRKD-----------------CEKLAGEGRMNN 503
                       ..|.|.....:.::.   |..|.||                 |||.........
  Fly   344 RDSDAAKALLIRRLRCLAAYEAANRNLEKARSKNKDVHAPLEVQEAETAQAEACEKFESMSACGK 408

  Fly   504 PQLHDV-NRRTDVVSYTVL----AELTHFKSERDTHLKHTL 539
            .:|... |||......:::    .|:.|.|::.: :|:.:|
  Fly   409 EELIGFRNRRVAAFKKSLVELSELEIKHAKTQYE-YLRQSL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3PX1NP_648348.1 SH3_SNX9_like 4..59 CDD:212697
PX_SNX9_18_like 219..343 CDD:132772 34/158 (22%)
BAR_SNX9_like 362..564 CDD:153310 41/226 (18%)
Snx6NP_001245939.1 PX_SNX5_like 72..212 CDD:132802 33/160 (21%)
BAR_SNX5_6 228..452 CDD:153305 46/244 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.