DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3PX1 and SNX11

DIOPT Version :9

Sequence 1:NP_648348.1 Gene:SH3PX1 / 39136 FlyBaseID:FBgn0040475 Length:565 Species:Drosophila melanogaster
Sequence 2:NP_037455.2 Gene:SNX11 / 29916 HGNCID:14975 Length:270 Species:Homo sapiens


Alignment Length:123 Identity:33/123 - (26%)
Similarity:59/123 - (47%) Gaps:18/123 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 CEMAYITQVEDSIYQWTQNHSPYSVVVASPKKESKFKGMKTFIAYQLTPSFNNIS-------VSR 254
            |.|:...:.|:.|          :|.|..|:.::: ....:::.|::....|:.:       |.|
Human     5 CRMSENQEQEEVI----------TVRVQDPRVQNE-GSWNSYVDYKIFLHTNSKAFTAKTSCVRR 58

  Fly   255 RYKHFDWLHERLVDKFCLIPVPPLPDKQISGRYEEQFVEHRRVQLQEFVDWVCRHPVI 312
            ||:.|.||.::|.....|:|||.||.|.......::|:|.||..||.|::.|.:..|:
Human    59 RYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVL 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3PX1NP_648348.1 SH3_SNX9_like 4..59 CDD:212697
PX_SNX9_18_like 219..343 CDD:132772 29/101 (29%)
BAR_SNX9_like 362..564 CDD:153310
SNX11NP_037455.2 PX_SNX10 18..129 CDD:132808 29/100 (29%)
Important for membrane trafficking 135..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..203
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.