DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3PX1 and Snx5

DIOPT Version :9

Sequence 1:NP_648348.1 Gene:SH3PX1 / 39136 FlyBaseID:FBgn0040475 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_006235181.1 Gene:Snx5 / 296199 RGDID:1310190 Length:404 Species:Rattus norvegicus


Alignment Length:365 Identity:76/365 - (20%)
Similarity:149/365 - (40%) Gaps:63/365 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 KTFIAYQLTPSFNNISVSRRYKHFDWLHERLVD--KFCLIPVPPLPDK----------QISGRYE 288
            ||.:....:|.|   ||:|:::.|.|||:.|.:  .:..:.:||.|.|          |..|..|
  Rat    52 KTTLPTFQSPEF---SVTRQHEDFVWLHDTLTETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGE 113

  Fly   289 -----EQFVEHRR-------------VQLQE-FVDWVCRHPVISKCEVWYHFLTCRDEKIWKSGK 334
                 |:|.:.::             |...| |:..:..|||:||...::.||. .|:.:  |.:
  Rat   114 GSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLE-YDQDL--SVR 175

  Fly   335 RKAERDPYMGVNYCLAISPPDKNLLHSKVDAQVELGTQFIHSMDVAVRNLNNISNDMAKR-SMSQ 398
            ||..::.:.|  :..::......:|.|.|.   |:...|....:..:...|.|.:..||. .|::
  Rat   176 RKNTKEMFGG--FFKSVVKSADEVLFSGVK---EVDDFFEQEKNFLINYYNRIKDSCAKADKMTR 235

  Fly   399 SKKEFQRIGDGLSDLA---KALAIDERRAPTRNAVPLSESVGRIGGIFIGIGQAFGDQPKHDWIP 460
            |.|   .:.|.....|   .:||::|   ||    .:.:.:.::..:|..:.:..|.....:.:.
  Rat   236 SHK---NVADDYIHTAACLHSLALEE---PT----VIKKYLLKVAELFEKLRKVEGRVSSDEDLK 290

  Fly   461 LSDRLHIYRGVLNCFPDIFSTHKGAIQKRKDCEKLAGEGRMNNPQL-------HDVNRRTDVVSY 518
            |::.|..|...:....|:......|:...::..|...:.|:.:..:       .:..::.:.:|.
  Rat   291 LTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAETHQQECCQKFEQLSE 355

  Fly   519 TVLAELTHFKSERDTHLKHTLKNFIAEQIKFYQGVVARLQ 558
            :...||.:||.:|....:..|......:||..:..|:.||
  Rat   356 SAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3PX1NP_648348.1 SH3_SNX9_like 4..59 CDD:212697
PX_SNX9_18_like 219..343 CDD:132772 35/137 (26%)
BAR_SNX9_like 362..564 CDD:153310 38/208 (18%)
Snx5XP_006235181.1 PX_SNX5 29..169 CDD:132824 31/120 (26%)
BAR_SNX5 185..402 CDD:153347 41/226 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.