DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SH3PX1 and Snx32

DIOPT Version :9

Sequence 1:NP_648348.1 Gene:SH3PX1 / 39136 FlyBaseID:FBgn0040475 Length:565 Species:Drosophila melanogaster
Sequence 2:XP_011246919.1 Gene:Snx32 / 225861 MGIID:2444704 Length:461 Species:Mus musculus


Alignment Length:272 Identity:52/272 - (19%)
Similarity:103/272 - (37%) Gaps:71/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 QNHSPYSVVVA---SPKKESKF-----KGMKTFIAYQLTPSFNNISVSRRYKHFDWLHERLVDK- 269
            |..||..|.::   |.:.:.||     .|:..|       :.:..||.|:::.|.|||:..|:. 
Mouse    22 QGDSPLQVEISDAVSERDKVKFTVQTKSGLPHF-------AQSEFSVVRQHEEFIWLHDTYVENE 79

  Fly   270 ----FCLIPVPPLPD--------------------KQISGRYEEQFVEH-----RRVQLQE-FVD 304
                ..:.|.||.||                    ::.|...:|...|:     :.|.:.| |:.
Mouse    80 EYAGLIIPPAPPRPDFEASREKLQKLGEGNSSITREEFSKMKQELEAEYLAIFKKTVAMHEVFLQ 144

  Fly   305 WVCRHPVISKCEVWYHF------LTCRDEK-------IWKSGKRKAERDPYMGVNYCLAIS---P 353
            .:..||.:.:...:..|      |:.|::.       :.:|..|.|:.....|::....:.   .
Mouse   145 RLAAHPTLRRDHNFSVFLEYSQDLSVREKNRKEVLGGLLRSIVRSADEVLITGISGLKEVDDFFE 209

  Fly   354 PDKNLL---HSKVDAQVELGTQFIHSMDVAVRNLNNIS---NDMAKRSMSQSKKEFQRIGDGLSD 412
            .::..|   |:::....:...:.:||......|...||   :.:..:.::|.|:.|.::.:....
Mouse   210 HERTFLVEYHTRIRDTCQRADRVMHSHKCLADNYIPISAALSSLGTQEVNQLKRSFLKLAELFER 274

  Fly   413 LAK---ALAIDE 421
            |.|   .:|.||
Mouse   275 LRKLEGRVASDE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SH3PX1NP_648348.1 SH3_SNX9_like 4..59 CDD:212697
PX_SNX9_18_like 219..343 CDD:132772 33/175 (19%)
BAR_SNX9_like 362..564 CDD:153310 13/66 (20%)
Snx32XP_011246919.1 PX_SNX5_like 27..164 CDD:132802 28/143 (20%)
BAR 181..>305 CDD:386243 19/106 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845762
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.