powered by:
Protein Alignment SH3PX1 and snx11
DIOPT Version :9
Sequence 1: | NP_648348.1 |
Gene: | SH3PX1 / 39136 |
FlyBaseID: | FBgn0040475 |
Length: | 565 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001120555.1 |
Gene: | snx11 / 100145709 |
XenbaseID: | XB-GENE-1005985 |
Length: | 165 |
Species: | Xenopus tropicalis |
Alignment Length: | 63 |
Identity: | 26/63 - (41%) |
Similarity: | 39/63 - (61%) |
Gaps: | 3/63 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 252 VSRRYKHFDWLHERLVDKFCLIPVPPLPDKQ--ISGRYEEQFVEHRRVQLQEFVDWVCRHPVI 312
|.|||:.||||.:||.....|:|||.||.|. :.|. .:.|:|.||..||:|::.:.::.|:
Frog 51 VRRRYREFDWLRKRLQKNSGLVPVPALPGKLPFLVGN-NDDFIERRRQGLQQFLEQIVQNMVL 112
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.