DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and PEX4

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_011649.1 Gene:PEX4 / 853034 SGDID:S000003365 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:163 Identity:54/163 - (33%)
Similarity:82/163 - (50%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANMAVSRIKREFKEVMR---SEEIVQCSIK--IELVN-------DSWTELRGEIAGPPDTPYEGG 54
            ::..:|||.:|:|.:::   |::.:....:  ||.:|       ..|..:   |:||.|||||..
Yeast    15 SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAI---ISGPSDTPYENH 76

  Fly    55 KFVLEIKVPETYPFNPPKVRFI-TRIWHPNISSVTGAICLDILK-DNWAAAMTLRTVLLSLQALL 117
            :|.:.|:||.:||.||||:.|: ..|.|.|:.|.||.|||:||| :.|.....|...:.::..||
Yeast    77 QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLL 141

  Fly   118 AAAEPDDPQDAVV----------AYQFKDKYDL 140
            .....|.|.|..:          |||...||.|
Yeast   142 REPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 54/163 (33%)
UQ_con 8..149 CDD:278603 53/157 (34%)
UBA_II_E2_UBCD4 163..198 CDD:270574
PEX4NP_011649.1 COG5078 15..176 CDD:227410 54/163 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S653
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.