DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UBC1

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_010462.3 Gene:UBC1 / 851757 SGDID:S000002584 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:193 Identity:86/193 - (44%)
Similarity:118/193 - (61%) Gaps:4/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VSRIKREFKEVMRSEEIVQCSIKIELVNDS-WTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFN 69
            :||.||..||:...::.....|.:|.|::| ...|:|...|||.|||||||||::|:||..|||.
Yeast     1 MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFK 65

  Fly    70 PPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQF 134
            |||::|.|:::|||||||||||||||||:.|:..:||::.|:||||||.:.||:|||||.||..:
Yeast    66 PPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHY 130

  Fly   135 KDKYDLFLLTAKHWTNAYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATEGL 197
            ....:.|..||..||..||.  .|.......::.....||| |:.......:.:..:|..|.|
Yeast   131 LRDRESFNKTAALWTRLYAS--ETSNGQKGNVEESDLYGID-HDLIDEFESQGFEKDKIVEVL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 76/147 (52%)
UQ_con 8..149 CDD:278603 73/141 (52%)
UBA_II_E2_UBCD4 163..198 CDD:270574 7/35 (20%)
UBC1NP_010462.3 COG5078 1..151 CDD:227410 78/151 (52%)
UBA_3 161..215 CDD:117832 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I1009
eggNOG 1 0.900 - - E2759_KOG0418
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3903
Inparanoid 1 1.050 156 1.000 Inparanoid score I1083
Isobase 1 0.950 - 0 Normalized mean entropy S653
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003491
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103192
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2383
TreeFam 1 0.960 - -
1211.770

Return to query results.
Submit another query.