DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UBC27

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001190508.1 Gene:UBC27 / 835159 AraportID:AT5G50870 Length:203 Species:Arabidopsis thaliana


Alignment Length:201 Identity:88/201 - (43%)
Similarity:128/201 - (63%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPP 71
            |||::|.::..|:::  ...|::...:|:.|.|.|.|.||..||||||.|.::|.:|:.|||.||
plant     5 SRIQKELQDCERNQD--SSGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPP 67

  Fly    72 KVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ--- 133
            |::|.|::|||||||.:||||||||||.|:.|:||:|.|:|:||||:|.||.||||||||.|   
plant    68 KMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQVLL 132

  Fly   134 --------FKDKYDLFLLTAKHWTNAYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSK----E 186
                    :...|.:|:.||::||..:|    .....:.|::||.:||..:.:.|:.:..    |
plant   133 LHHLNHLRYMKNYQVFVSTARYWTETFA----KKSSLEEKVKRLVEMGFGDAQVRSAIESSGGDE 193

  Fly   187 NWNLEK 192
            |..|||
plant   194 NLALEK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 76/156 (49%)
UQ_con 8..149 CDD:278603 73/151 (48%)
UBA_II_E2_UBCD4 163..198 CDD:270574 11/34 (32%)
UBC27NP_001190508.1 COG5078 5..162 CDD:227410 77/162 (48%)
UQ_con 6..156 CDD:278603 73/151 (48%)
UBA_II_E2_UBC27_like 166..201 CDD:270497 11/34 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 154 1.000 Domainoid score I1359
eggNOG 1 0.900 - - E2759_KOG0418
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3903
Inparanoid 1 1.050 176 1.000 Inparanoid score I1487
OMA 1 1.010 - - QHG57104
OrthoDB 1 1.010 - - D1418652at2759
OrthoFinder 1 1.000 - - FOG0003491
OrthoInspector 1 1.000 - - oto3092
orthoMCL 1 0.900 - - OOG6_103192
Panther 1 1.100 - - LDO PTHR24068
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2383
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.