DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UBC9

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_567791.1 Gene:UBC9 / 828909 AraportID:AT4G27960 Length:178 Species:Arabidopsis thaliana


Alignment Length:152 Identity:64/152 - (42%)
Similarity:91/152 - (59%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            ||..||.:|.|: ::.:....||  ...|.:.....:..|.||.|:||.||.|::.|..|..|||
plant    31 MASKRILKELKD-LQKDPPTSCS--AGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPF 92

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            .||||.|.|:::||||:| .|:|||||||:.|:.|:|:..||||:.:||....||||....:|:.
plant    93 KPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHM 156

  Fly   134 FKDKYDLFLLTAKHWTNAYAGG 155
            :|...:.:..||:.||..||.|
plant   157 YKTDKNKYESTARTWTQKYAMG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 59/144 (41%)
UBA_II_E2_UBCD4 163..198 CDD:270574
UBC9NP_567791.1 UBCc_UBE2D 33..175 CDD:467412 59/145 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.