DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ube2b

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_006246405.1 Gene:Ube2b / 81816 RGDID:708345 Length:180 Species:Rattus norvegicus


Alignment Length:156 Identity:48/156 - (30%)
Similarity:83/156 - (53%) Gaps:9/156 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPET 65
            |:..|..|:.|:||.:.....:.......|.....|..:   |.||..||:|.|.|.|.|:..|.
  Rat    29 MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAV---IFGPEGTPFEDGTFKLVIEFSEE 90

  Fly    66 YPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130
            ||..||.|||:::::|||:.: .|:||||||::.|:....:.::|.|:|:||....|:.|.::..
  Rat    91 YPNKPPTVRFLSKMFHPNVYA-DGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQA 154

  Fly   131 AYQF---KDKYD--LFLLTAKHWTNA 151
            |..:   |.:|:  :..:..:.|.::
  Rat   155 AQLYQENKREYEKRVSAIVEQSWNDS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 48/156 (31%)
UQ_con 8..149 CDD:278603 45/145 (31%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ube2bXP_006246405.1 UQ_con 36..173 CDD:395127 45/140 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.