DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ube2dnl2

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001075130.1 Gene:Ube2dnl2 / 75097 MGIID:1922347 Length:155 Species:Mus musculus


Alignment Length:150 Identity:60/150 - (40%)
Similarity:86/150 - (57%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            ||:.||::|...:.: :....||  ...|.::....:..|.||.|:||:||.|.|.:..|..|||
Mouse     9 MALKRIQKELVAISQ-DPPAHCS--AGPVAENMFHWQATIMGPEDSPYQGGVFFLSVHFPNNYPF 70

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            .||||.||||::|||||. .|:||||||...|:.|:|:..:|||:.:||....||||....:|..
Mouse    71 KPPKVTFITRVYHPNISK-NGSICLDILNSMWSPALTISKLLLSICSLLCDPNPDDPLVPEIAKV 134

  Fly   134 FKDKYDLFLLTAKHWTNAYA 153
            ::.....:...|:.||..||
Mouse   135 YRKDLREYNRLAREWTKRYA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 56/144 (39%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ube2dnl2NP_001075130.1 UBCc_UEV 11..153 CDD:483950 56/145 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.