DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UBE2E1

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_003332.1 Gene:UBE2E1 / 7324 HGNCID:12477 Length:193 Species:Homo sapiens


Alignment Length:156 Identity:64/156 - (41%)
Similarity:89/156 - (57%) Gaps:10/156 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPET 65
            :.:.:..||::|..:: ..:....||...:  .|:..|.|..|.|||.:.||||.|.|:|.....
Human    44 LLSTSAKRIQKELADI-TLDPPPNCSAGPK--GDNIYEWRSTILGPPGSVYEGGVFFLDITFTPE 105

  Fly    66 YPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130
            |||.||||.|.|||:|.||:| .|.||||||||||:.|:|:..||||:.:||....|.||....:
Human   106 YPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSI 169

  Fly   131 AYQF---KDKYDLFLLTAKHWTNAYA 153
            |.|:   :.::|..   |:.||..||
Human   170 ATQYMTNRAEHDRM---ARQWTKRYA 192

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 62/154 (40%)
UQ_con 8..149 CDD:278603 60/143 (42%)
UBA_II_E2_UBCD4 163..198 CDD:270574