DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UBE2D3

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_871622.1 Gene:UBE2D3 / 7323 HGNCID:12476 Length:149 Species:Homo sapiens


Alignment Length:145 Identity:62/145 - (42%)
Similarity:84/145 - (57%) Gaps:4/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKV 73
            :.:|..::.| :...|||  ...|.|.....:..|.||.|:||:||.|.|.|..|..|||.||||
Human     8 LSKELSDLAR-DPPAQCS--AGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKV 69

  Fly    74 RFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKY 138
            .|.|||:||||:| .|:||||||:..|:.|:|:..||||:.:||....||||....:|..:|...
Human    70 AFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDR 133

  Fly   139 DLFLLTAKHWTNAYA 153
            |.:...::.||..||
Human   134 DKYNRISREWTQKYA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 60/141 (43%)
UBA_II_E2_UBCD4 163..198 CDD:270574
UBE2D3NP_871622.1 UBCc_UBE2D 6..147 CDD:467412 60/142 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.