DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UBE2D2

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_016865309.1 Gene:UBE2D2 / 7322 HGNCID:12475 Length:173 Species:Homo sapiens


Alignment Length:130 Identity:60/130 - (46%)
Similarity:77/130 - (59%) Gaps:3/130 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVT 88
            |||  ...|.|.....:..|.||.|:||:||.|.|.|..|..|||.||||.|.|||:||||:| .
Human    46 QCS--AGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-N 107

  Fly    89 GAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYA 153
            |:||||||:..|:.|:|:..||||:.:||....||||....:|..:|...:.:...|:.||..||
Human   108 GSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 172

  Fly   154  153
            Human   173  172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 58/128 (45%)
UQ_con 8..149 CDD:278603 56/124 (45%)
UBA_II_E2_UBCD4 163..198 CDD:270574
UBE2D2XP_016865309.1 COG5078 35..173 CDD:227410 60/130 (46%)
UBCc 35..172 CDD:294101 58/128 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.