DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UBE2D1

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_003329.1 Gene:UBE2D1 / 7321 HGNCID:12474 Length:147 Species:Homo sapiens


Alignment Length:150 Identity:62/150 - (41%)
Similarity:88/150 - (58%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            ||:.||::|..::.| :....||  ...|.|.....:..|.||||:.|:||.|.|.:..|..|||
Human     1 MALKRIQKELSDLQR-DPPAHCS--AGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPF 62

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            .|||:.|.|:|:||||:| .|:||||||:..|:.|:|:..||||:.:||....||||....:|..
Human    63 KPPKIAFTTKIYHPNINS-NGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQI 126

  Fly   134 FKDKYDLFLLTAKHWTNAYA 153
            :|...:.:...|:.||..||
Human   127 YKSDKEKYNRHAREWTQKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 58/144 (40%)
UBA_II_E2_UBCD4 163..198 CDD:270574
UBE2D1NP_003329.1 UBCc_UBE2D 3..145 CDD:467412 58/145 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.