DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ube2t

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001265044.1 Gene:Ube2t / 67196 MGIID:1914446 Length:204 Species:Mus musculus


Alignment Length:124 Identity:61/124 - (49%)
Similarity:79/124 - (63%) Gaps:5/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDIL-- 96
            |...:||.:|.|..:||||.|.|.||:.:||.|||.||:|||:|.|:||||.| :|.||||||  
Mouse    29 DQVADLRAQILGGANTPYEKGVFTLEVIIPERYPFEPPQVRFLTPIYHPNIDS-SGRICLDILKL 92

  Fly    97 --KDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYA 153
              |..|..::.:.|||.|:|.|:|...||||..|.::.:||.....||..||.||.|:|
Mouse    93 PPKGAWRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYNKIAFLKKAKQWTEAHA 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 60/122 (49%)
UQ_con 8..149 CDD:278603 57/118 (48%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ube2tNP_001265044.1 COG5078 1..151 CDD:227410 60/122 (49%)
UBCc 5..147 CDD:238117 57/118 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..204 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.