DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ube2d3

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_036019109.1 Gene:Ube2d3 / 66105 MGIID:1913355 Length:148 Species:Mus musculus


Alignment Length:150 Identity:67/150 - (44%)
Similarity:88/150 - (58%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            ||:.||.:|..::.| :...|||  ...|.|.....:..|.||.|:||:||.|.|.|..|..|||
Mouse     1 MALKRINKELSDLAR-DPPAQCS--AGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPF 62

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQ 133
            .||||.|.|||:||||:| .|:||||||:..|:.|:|:..||||:.:||....||||....:|..
Mouse    63 KPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARI 126

  Fly   134 FKDKYDLFLLTAKHWTNAYA 153
            :|...|.:...|:.||..||
Mouse   127 YKTDRDKYNRLAREWTEKYA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 63/144 (44%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ube2d3XP_036019109.1 UBCc_UBE2D 3..145 CDD:467412 63/145 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.