DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and ube2e1

DIOPT Version :10

Sequence 1:NP_524010.2 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001096586.1 Gene:ube2e1 / 563542 ZFINID:ZDB-GENE-071004-16 Length:195 Species:Danio rerio


Alignment Length:156 Identity:66/156 - (42%)
Similarity:90/156 - (57%) Gaps:10/156 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPET 65
            :.:.:..||::|..::| .:....||...:  .|:..|.|..|.|||.:.||||.|.|:|.....
Zfish    46 LLSTSAKRIQKELADIM-LDPPPNCSAGPK--GDNIYEWRSTILGPPGSVYEGGVFFLDIAFTPD 107

  Fly    66 YPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130
            |||.||||.|.|||:|.||:| .|.||||||||||:.|:|:..||||:.:||....|.||....:
Zfish   108 YPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSI 171

  Fly   131 AYQF---KDKYDLFLLTAKHWTNAYA 153
            |.|:   :.::|..   ||.||..||
Zfish   172 ATQYTTNRPEHDRI---AKQWTKRYA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_524010.2 UBCc_UBE2K 6..151 CDD:467420 64/147 (44%)
UBA_II_E2_UBCD4 163..198 CDD:270574
ube2e1NP_001096586.1 UBCc_UBE2E 52..192 CDD:467413 64/146 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.