DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and ube2k

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001005662.1 Gene:ube2k / 448153 XenbaseID:XB-GENE-983372 Length:200 Species:Xenopus tropicalis


Alignment Length:199 Identity:136/199 - (68%)
Similarity:162/199 - (81%) Gaps:0/199 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPET 65
            |||:|..|||||||||::|||..:..||::||:::::|||||||||||||||||::.||||:|||
 Frog     1 MANIAAQRIKREFKEVLKSEETSKNQIKVDLVDENFSELRGEIAGPPDTPYEGGRYQLEIKIPET 65

  Fly    66 YPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130
            ||||||||||||:||||||||||||||||||||.|||||||||||||||||||||||||||||||
 Frog    66 YPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130

  Fly   131 AYQFKDKYDLFLLTAKHWTNAYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATE 195
            |.|:|...::|..||:.|.:.|||.|.|.|:...||:.|..||.|.:...|.||.:.|::|.|||
 Frog   131 ANQYKQNPEMFKQTARLWAHVYAGAPVTSPEYTKKIENLCAMGFDRNAVIAALSSKAWDVETATE 195

  Fly   196 GLFS 199
            .|.|
 Frog   196 LLLS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 114/151 (75%)
UQ_con 8..149 CDD:278603 109/140 (78%)
UBA_II_E2_UBCD4 163..198 CDD:270574 14/34 (41%)
ube2kNP_001005662.1 UQ_con 8..149 CDD:365926 109/140 (78%)
UBA_II_E2_UBE2K 163..200 CDD:270573 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2470
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3903
Inparanoid 1 1.050 278 1.000 Inparanoid score I2864
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1418652at2759
OrthoFinder 1 1.000 - - FOG0003491
OrthoInspector 1 1.000 - - oto104437
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2383
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.