DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and vih

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_648582.1 Gene:vih / 44118 FlyBaseID:FBgn0264848 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:56/155 - (36%)
Similarity:80/155 - (51%) Gaps:31/155 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NMAVSRIKREFKEVMRSEEIVQCSIKIELVND-------------SWTELRGEIAGPPDTPYEGG 54
            |.|||  ||..||:|          .:.:.|:             .|.   |.||||.:|.|.|.
  Fly    30 NHAVS--KRLHKELM----------NLMMANERGISAFPDGENIFKWV---GTIAGPRNTVYSGQ 79

  Fly    55 KFVLEIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAA 119
            .:.|.:..|.:||:..|.|:|:|..:|||: .:.||||||||||.|:|...:||:|||:|:||..
  Fly    80 TYRLSLDFPNSYPYAAPVVKFLTSCFHPNV-DLQGAICLDILKDKWSALYDVRTILLSIQSLLGE 143

  Fly   120 AEPDDPQDAVVAYQFKD--KYDLFL 142
            ...:.|.:|..|..:.|  :|..:|
  Fly   144 PNNESPLNAQAAMMWNDQKEYKKYL 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 56/155 (36%)
UQ_con 8..149 CDD:278603 52/150 (35%)
UBA_II_E2_UBCD4 163..198 CDD:270574
vihNP_648582.1 COG5078 31..166 CDD:227410 54/150 (36%)
UQ_con 36..172 CDD:278603 51/147 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.