DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ubc7

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001285334.1 Gene:Ubc7 / 44054 FlyBaseID:FBgn0267384 Length:167 Species:Drosophila melanogaster


Alignment Length:173 Identity:53/173 - (30%)
Similarity:84/173 - (48%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANMAVSRIKREFKEVMRS--EEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVP 63
            ||..|:.|:..|:|::...  |.||...|.    .|::.|....||||..|.:|||.|...:..|
  Fly     1 MAGSALRRLMAEYKQLTLDPPEGIVAGPIS----EDNFFEWEALIAGPEGTCFEGGVFPARLIFP 61

  Fly    64 ETYPFNPPKVRFITRIWHPNISSVTGAICLDIL-------------KDNWAAAMTLRTVLLSLQA 115
            ..||.:|||::|...::||||.: .|.:|:.||             .:.|:...::..:|||:.:
  Fly    62 TDYPLSPPKMKFTCDMFHPNIFA-DGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVS 125

  Fly   116 LLAAAEPDDPQDAVV--AYQFKDKYDLFLLTAKHWTNAYAGGP 156
            :|  |||:|...|.|  |..::::.|.|...|:.......|.|
  Fly   126 ML--AEPNDESGANVDAAIMWREQRDEFNAIARRLVRKTLGLP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 51/168 (30%)
UQ_con 8..149 CDD:278603 48/157 (31%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ubc7NP_001285334.1 COG5078 1..163 CDD:227410 51/168 (30%)
UQ_con 8..159 CDD:278603 48/157 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438048
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.