DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG14739

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_650151.1 Gene:CG14739 / 41467 FlyBaseID:FBgn0037987 Length:206 Species:Drosophila melanogaster


Alignment Length:186 Identity:54/186 - (29%)
Similarity:88/186 - (47%) Gaps:22/186 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPF 68
            ||..|:.|:...::.|....       .|:|..|.|...:.||..:.||||.:.:.:.:|:.||.
  Fly    13 MAGRRLDRDVNRLLASGYRT-------TVDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPL 70

  Fly    69 NPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLS-LQALLAAAEPDDPQDAVVAY 132
            ..|:|||:|:|.||||..:||.:|:::||..|:::..|..:..: |..||....|.|..:...|.
  Fly    71 TAPRVRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAA 135

  Fly   133 QFKDKYDLF----LLTAKHWTNAYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLS 184
            ..|....||    :|..|    .|| .|...|     .::|.:.|:::..:...||
  Fly   136 IMKHSEQLFREHVILCMK----TYA-M
PANLP-----TRQLVEEGLEKRSSDLSLS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 46/153 (30%)
UQ_con 8..149 CDD:278603 44/145 (30%)
UBA_II_E2_UBCD4 163..198 CDD:270574 4/22 (18%)
CG14739NP_650151.1 COG5078 12..157 CDD:227410 48/155 (31%)
UQ_con 17..152 CDD:278603 43/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.