DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ubc84D

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_524260.1 Gene:Ubc84D / 40900 FlyBaseID:FBgn0017456 Length:153 Species:Drosophila melanogaster


Alignment Length:153 Identity:51/153 - (33%)
Similarity:79/153 - (51%) Gaps:11/153 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVSRIKREFKEVMRSEEIVQCSIKIELVNDS---WTELRGEIAGPPDTPYEGGKFVLEIKVPETY 66
            |..|:.||..:::.::  :.....||..::|   ||.|    ..|...||..|.|.:||..|..|
  Fly     3 ATRRLTRELSDLVEAK--MSTLRNIESSDESLLMWTGL----LVPEKAPYNKGAFRIEINFPPQY 61

  Fly    67 PFNPPKVRFITRIWHPNISSVTGAICLDILK-DNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130
            ||.|||:.|.|:|:|||:.. .|.:||.|:. |||........||.:|.|::...||:.|..:.:
  Fly    62 PFMPPKILFKTKIYHPNVDE-KGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDL 125

  Fly   131 AYQFKDKYDLFLLTAKHWTNAYA 153
            |.:|..::..|:.||:.:|...|
  Fly   126 AEEFVREHKKFMKTAEEFTKKNA 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 50/151 (33%)
UQ_con 8..149 CDD:278603 48/144 (33%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ubc84DNP_524260.1 COG5078 1..150 CDD:227410 51/153 (33%)
UBCc 6..149 CDD:214562 50/150 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.