DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Ubc6

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001246916.1 Gene:Ubc6 / 40610 FlyBaseID:FBgn0004436 Length:151 Species:Drosophila melanogaster


Alignment Length:136 Identity:47/136 - (34%)
Similarity:77/136 - (56%) Gaps:4/136 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPET 65
            |:..|..|:.|:||   |.:|.....:.....:::.......|.||.|||:|.|.|.|.|:..|.
  Fly     1 MSTPARRRLMRDFK---RLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEE 62

  Fly    66 YPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130
            ||..||.|||:::::|||:.: .|.||||||::.|:....:..:|.|:|:||:...|:.|.::..
  Fly    63 YPNKPPTVRFVSKVFHPNVYA-DGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTA 126

  Fly   131 AYQFKD 136
            |..:|:
  Fly   127 AQLYKE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 47/136 (35%)
UQ_con 8..149 CDD:278603 45/129 (35%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Ubc6NP_001246916.1 UQ_con 8..145 CDD:395127 45/129 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.