DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG7656

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_648783.4 Gene:CG7656 / 39691 FlyBaseID:FBgn0036516 Length:319 Species:Drosophila melanogaster


Alignment Length:153 Identity:52/153 - (33%)
Similarity:80/153 - (52%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANMAVSRIKREFKEVMRSEEIVQCSIKIELVND----SWTELRGEIA--GPPDTPYEGGKFVLEI 60
            ::.||..:..|:|.:  .||.|: ..:::|:||    .|     |:|  |||||.|:||.|...:
  Fly    38 SSSAVRALAMEYKSL--QEEPVE-GFRVKLINDDNLFEW-----EVAIFGPPDTLYQGGYFKAHM 94

  Fly    61 KVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILK-------------DNWAAAMTLRTVLLS 112
            |.|..||::||.:||:|::||||:.. .|.:|:.||.             :.|.....:||:|||
  Fly    95 KFPHDYPYSPPSIRFLTKVWHPNVYE-NGDLCISILHPPVDDPQSGELPCERWNPTQNVRTILLS 158

  Fly   113 LQALLAAAEPDDPQ--DAVVAYQ 133
            :.:||.......|.  ||.|.|:
  Fly   159 VISLLNEPNTFSPANVDASVMYR 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 52/153 (34%)
UQ_con 8..149 CDD:278603 50/147 (34%)
UBA_II_E2_UBCD4 163..198 CDD:270574
CG7656NP_648783.4 UBCc 42..186 CDD:238117 51/149 (34%)
COG5078 45..182 CDD:227410 50/146 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438057
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.