DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and UbcE2M

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001261567.1 Gene:UbcE2M / 38916 FlyBaseID:FBgn0035853 Length:181 Species:Drosophila melanogaster


Alignment Length:175 Identity:46/175 - (26%)
Similarity:78/175 - (44%) Gaps:35/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGE--------IAGPPDTPYEGGKFVL 58
            |:.|..||:::..|             :.|.|...|:....        |..|.:..|..|:||.
  Fly    24 ASAAQLRIQKDINE-------------LNLPNTCATDFPDPNDLLNFKLIISPDEGFYRDGRFVF 75

  Fly    59 EIKVPETYPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPD 123
            ..:|...||..||||:..|:::|||| .:.|.:||:||:::|...:.:.:::..||.|.....|:
  Fly    76 NFRVGSNYPHEPPKVKCATQVYHPNI-DLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPE 139

  Fly   124 DPQDAVVAYQFKDKYDLFLLTAKHWTN----AYAGG--PHTFPDC 162
            ||.:       |:..|:.....:.:.|    |..||  ..|:.:|
  Fly   140 DPLN-------KEAADVLQTNRRQFENNVKKAMRGGCVGETYFEC 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 42/162 (26%)
UQ_con 8..149 CDD:278603 38/148 (26%)
UBA_II_E2_UBCD4 163..198 CDD:270574 46/175 (26%)
UbcE2MNP_001261567.1 UQ_con 30..165 CDD:395127 39/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.