DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and Uev1A

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001286940.1 Gene:Uev1A / 38613 FlyBaseID:FBgn0035601 Length:145 Species:Drosophila melanogaster


Alignment Length:139 Identity:39/139 - (28%)
Similarity:67/139 - (48%) Gaps:25/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAN-----MAVSRIKREFKEVMRSEE-IVQCSIKIELVNDS------WTELRGEIAGPPDTPYEG 53
            |||     :.|.|..|..:|:.:.:: :...:|...|.||.      |.   |.|.|||.||:|.
  Fly     1 MANTSSTGVVVPRNFRLLEELDQGQKGVGDGTISWGLENDDDMTLTYWI---GMIIGPPRTPFEN 62

  Fly    54 GKFVLEIKVPETYPFNPPKVRFITRIWHPNISSV---TGAI---CLDILKDNWAAAMTLRTVLLS 112
            ..:.|:|:..|.||..||.:||||::   ||:.:   .|.:   .:.:|. .|:....::|:|..
  Fly    63 RMYSLKIECGERYPDEPPTLRFITKV---NINCINQNNGVVDHRSVQMLA-RWSREYNIKTMLQE 123

  Fly   113 LQALLAAAE 121
            ::.::...|
  Fly   124 IRRIMTMKE 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 39/139 (28%)
UQ_con 8..149 CDD:278603 35/127 (28%)
UBA_II_E2_UBCD4 163..198 CDD:270574
Uev1ANP_001286940.1 UBCc 16..142 CDD:214562 34/124 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438055
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24068
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.